SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|506934534|ref|YP_008014972.1| from Amycolatopsis orientalis HCCB10007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506934534|ref|YP_008014972.1|
Domain Number 1 Region: 92-258
Classification Level Classification E-value
Superfamily TPR-like 1.74e-33
Family BTAD-like 0.00075
Further Details:      
 
Domain Number 2 Region: 254-521
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.88e-27
Family Extended AAA-ATPase domain 0.07
Further Details:      
 
Domain Number 3 Region: 703-870
Classification Level Classification E-value
Superfamily TPR-like 4.55e-20
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Domain Number 4 Region: 822-859,891-972
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000273
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 5 Region: 2-79
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000624
Family PhoB-like 0.00086
Further Details:      
 
Weak hits

Sequence:  gi|506934534|ref|YP_008014972.1|
Domain Number - Region: 537-628
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00317
Family ArsR-like transcriptional regulators 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|506934534|ref|YP_008014972.1|
Sequence length 991
Comment transcriptional activator domain-containing protein [Amycolatopsis orientalis HCCB10007]
Sequence
MEFRVLGAVEAWAGGVPVDLGSPKQRLVLAVLLLEAGKPVPRDRIIDLLWPEEPPASARN
TVQALVSRLRAVFRGAGGPEIVSEGTRYLLKVDARQVDLHRFTELTAQARDADDETAVEL
LDEALGLWRGEALSDVVSGEVAQRLRGGLHEARWTALEDRAEAQLRLGRGRQVLAELTEL
VAAHPLRQRFVGQLMLALHREGRTDDALDAFRSLRDRLGTELGLDPSPELRRLEAAILAA
DPALEPATRPEAVRPAQLPHDVRGFAGRAAELERLDEAAHAGGGTDIWVISGTAGVGKTA
LAVRWAHRVRDAFPDGQLYLDLRGFDPDHEPLTPAVALTQLLQALGTAPKAIPPDIDTRA
ALLRSLLADRRVLLVLDNVRDSGQVLPLLPPSGTVLVTSRQRLGDLIARTGARALPLSVL
PAEDARHLLEAVLGSETVAAEEGAAAELARLCGHLPLALRIAAANLGASGEPEIAELARE
LAGGDPLAELTVDGAEESAVTTAFGVSYRALPEEHRELFRRLALVPGQTFTAPAAQALTG
VPRSKANQQLKALAAAHLVERYTPGRYRFHDLLRSFAAGRTLSEDTKAEREAAERRLFES
YLTTADAAGRALIPHFLRLPREEPADAPFADTDEALAWLDAEWPNLAAAVEHSAEHGPPE
FSWHLADALRAFFHQRGHHAEWIDTASTALKAARRSEAGQAQAAMHLSIALACVNSGRYD
EAREHLTSALRGDLLDGWDAGRAAVLNNLSAVHQRLGDPQEAIRCGLESLRLCEELNMPA
VSMALANLGFPYWQTGQLDEALANFTRALAVSERDGARFSVAVLLVDLGNVHRDLGLPDD
AYDFYTRALAANRELGYTYGEATALSGRAVLESRRDPSEQNRTDALEAVELTRKIGDRGT
EAWTLVGLGEVCLRLGLPEEAAEHYRLALSIARTTSFFWCEAAARTGLAETLLKLGKLTE
ARTHGELALELAARSGYRLVEERAKLILDEL
Download sequence
Identical sequences R4SYZ8
WP_016336296.1.6660 gi|506934534|ref|YP_008014972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]