SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|506935677|ref|YP_008016115.1| from Amycolatopsis orientalis HCCB10007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506935677|ref|YP_008016115.1|
Domain Number 1 Region: 100-271
Classification Level Classification E-value
Superfamily TPR-like 1.35e-27
Family BTAD-like 0.0019
Further Details:      
 
Domain Number 2 Region: 264-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.47e-27
Family Gluconate kinase 0.051
Further Details:      
 
Domain Number 3 Region: 836-983
Classification Level Classification E-value
Superfamily TPR-like 4e-20
Family Tetratricopeptide repeat (TPR) 0.0094
Further Details:      
 
Domain Number 4 Region: 701-860
Classification Level Classification E-value
Superfamily TPR-like 9.48e-17
Family Tetratricopeptide repeat (TPR) 0.004
Further Details:      
 
Domain Number 5 Region: 4-95
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000000624
Family PhoB-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|506935677|ref|YP_008016115.1|
Sequence length 997
Comment SARP family transcriptional regulator [Amycolatopsis orientalis HCCB10007]
Sequence
MAVRIQVLGSLRVWLAGAEVDLGPPGRRAVLGLLVLAGGEAMSKQELVDALWGDRPPRSA
VNVLQTHVKHLRRLLEPGRPSRSGSEILPHVGGGYAVRWDAVEIDLPHVRGLVAEATGAQ
RDGETGRAAALFGEALRRWRGRPLADVPLLATHPKVVALLAERRALLARYGDAMLAIGAA
DEVLTELVEAAADQPLDEPAQARLLRAYHLAGQRASAFRLYQEVRERLLEELGVEPGPEL
VAAHAALLEDGEPLPGPPSAARVPRQLPAEPPGFTGRAIELSILDELVPRPGGSGGTVAL
AAVTGTAGAGKTALAVHWAHRVKGRFPDGQLYANLRGHSGGAPATALEVLTQFLAALEVP
AERLPADTETASALYRTLMTDRKALVVLDNAVDVAQVRPLLPAGPGCLVLVTARDRMAGL
VAFHGARRLTLGMLDTGEALELLARLLGAERIRAEHEAAAEVAGLCAYLPLALRIAAANL
ADDPGNGIEDYAIELRKGNLLAALTVPGDEQIAVRTAFDLSYAGLPAETRRLFRLLSLVP
GNDIGVEAVEILTGSDRAGRILDTLACAHLVEQHAPGRYHFHDLLRRYAADRLEARESPA
ERASARRRLHEWYLRGVDVAAKLLYPHMFRLPLSVPDGPVPAASAEWLETELGSLAAVAE
DAARTGPLPVAWLLSDALRGYFWMSSRQVEWRAAAGAALSAAEEDGDLRARASARFSLAD
LGFRQGRYREAVRGYTGALVLARRAGWMEAQAAVLGNLGCVYWQSGRLPAAAARFSRGLE
LSRRAGTTAGEAVALGNLGLVRWEMGDLPGAAGNYVEALRRYRGVGSRYGEAINLANLGQ
TQHARGRVTEAAGLLAKALALHREAGNHAGEAETLGRLASVYCDLGRRADALDHAREGLR
LARETGEPRGEGEALVALASVHQRAGHRQEAVRRYRQALVLLRETGDRYPEVDALIGLAT
VTGDLGQARHALALAERAGYRALRRRAAAAVESILRA
Download sequence
Identical sequences R4TG57
gi|506935677|ref|YP_008016115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]