SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332158358|ref|YP_004423637.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332158358|ref|YP_004423637.1|
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily PH domain-like 0.0000115
Family VPS36 N-terminal domain-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332158358|ref|YP_004423637.1|
Sequence length 105
Comment hypothetical protein PNA2_0717 [Pyrococcus sp. NA2]
Sequence
MALSDYLLPGEDIRFQSKSFVEYGGNRYQVIVTNKRIILYAQRGWIFKSDDVVTFKLEDI
QGIKYKEEGIIGKKGIIEIHAKTIAKLSGPASEMKALYQQLLGFL
Download sequence
Identical sequences F4HLT0
WP_013748187.1.68068 gi|332158358|ref|YP_004423637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]