SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332159349|ref|YP_004424628.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332159349|ref|YP_004424628.1|
Domain Number 1 Region: 159-275
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.06e-30
Family Homoserine kinase 0.0034
Further Details:      
 
Domain Number 2 Region: 1-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.34e-30
Family GHMP Kinase, N-terminal domain 0.0000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332159349|ref|YP_004424628.1|
Sequence length 294
Comment homoserine kinase [Pyrococcus sp. NA2]
Sequence
MKKRIYAPATIANFGPGFDVFGMAIEEPGDEVVVKESDSFEIEVEGHDVPRDDSNVAIVS
AKALFRMVGEEGGVSIKLKKGIRPKSGLGSSGASSVAGALAAARVLGVDNDELIIMAALE
GERAASGSPHGDNVVPSYYGGFNILESLKPLRVHRIDVELKVVVVLPEVEVPTREARKVV
PEKVPLKDAVKNLAMASSLVLALKEGDIETVGRLLDDNLALPYRKRLMPWFDEVRKAGLE
AGAYGVTISGSGPSLFAVGENLRDIGRAMKERFEELGIKAEFWVTKTGRGAKWY
Download sequence
Identical sequences F4HKL4
gi|332159349|ref|YP_004424628.1| WP_013749174.1.68068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]