SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313672036|ref|YP_004050147.1| from Calditerrivibrio nitroreducens DSM 19672

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313672036|ref|YP_004050147.1|
Domain Number 1 Region: 30-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.21e-24
Family Thioltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313672036|ref|YP_004050147.1|
Sequence length 146
Comment alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Calditerrivibrio nitroreducens DSM 19672]
Sequence
MKKYVLILLLLRFFISPSHAEVKYIDESGLNKLLHQGYNKTVLVFWATYCPYCKALLQTL
NENSIYFKRNKINIIAISVDKNPSLVTDFVEKVKYPFNFYIDRGDLKRKFNAYYIPVTAI
FDKDGRLEDTFPGNKPFSELKSYLEE
Download sequence
Identical sequences E4TIF9
gi|313672036|ref|YP_004050147.1| WP_013450201.1.25879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]