SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313673055|ref|YP_004051166.1| from Calditerrivibrio nitroreducens DSM 19672

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313673055|ref|YP_004051166.1|
Domain Number 1 Region: 185-498
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 8.25e-35
Family N-acylglucosamine (NAG) epimerase 0.095
Further Details:      
 
Domain Number 2 Region: 6-133
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.42e-21
Family Thioltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313673055|ref|YP_004051166.1|
Sequence length 566
Comment hypothetical protein Calni_1092 [Calditerrivibrio nitroreducens DSM 19672]
Sequence
MKTVLNSLRDENSLYLLQHADNPVKWISWSNYLKIKDSVVKPLFISIGYSSCHWCHVMAE
ESFSDENIASFLNDNFTPIKIDREEYPDLDKKYQFFAQITGSKGGWPLTIFADLDGSPFY
AGTYFPKEDRYGIPSLMRILESINNLYKNSYEKVKLTVENYQNFITKFYDCESLESKETD
SNAFKDLFDYKNGGLKGSAKFPNIPVMEYLLDHGDDSDIMEFLVKTADALCLSGIYDHID
GGFFRYTVDSDWNIPHFEKMLYDNALNISFLSKLYEKTENDLYLYTAKKTADFCIEFFDT
EYGFGASYDADSYDENGNKREGYFYTLTEEAFADLTVEEVRLLSEHCYFNNNHIRINNFI
NIDIFRKLQSIFSKISIRRSNLKKRPNFDNKVIFSWNCLMISALLDFYEVSSDEFYFNKA
LDSYFKIFHTMYVDGEINRVSYRGKLLKHSVLEDYVYFLSSTNKIFSITKDKNFLNIGKK
ILHDILEKFYIKNILWYNRSSDVVDIFDDATPSSFGLFLKECEMLGRYVDLNVDLDRFVE
FAKKMHSNYPFATPSLAIFLEKKYIN
Download sequence
Identical sequences E4TI87
WP_013451215.1.25879 gi|313673055|ref|YP_004051166.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]