SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313673078|ref|YP_004051189.1| from Calditerrivibrio nitroreducens DSM 19672

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|313673078|ref|YP_004051189.1|
Domain Number - Region: 7-62
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00201
Family Thioltransferase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313673078|ref|YP_004051189.1|
Sequence length 77
Comment alkylmercury lyase, partial [Calditerrivibrio nitroreducens DSM 19672]
Sequence
MVNIDLIYVEGCSSTPETLKLINEVVNDLGIEAKINTILVENSEQAKQWKFFGSPTVQIN
GVDIDPKMRNKEWFGIT
Download sequence
Identical sequences E4TIH8
WP_013451238.1.25879 gi|313673078|ref|YP_004051189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]