SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313673509|ref|YP_004051620.1| from Calditerrivibrio nitroreducens DSM 19672

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313673509|ref|YP_004051620.1|
Domain Number 1 Region: 104-344
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 3.01e-92
Family Nqo1 FMN-binding domain-like 0.000000282
Further Details:      
 
Domain Number 2 Region: 429-530
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 1.83e-36
Family Nqo1C-terminal domain-like 0.0008
Further Details:      
 
Domain Number 3 Region: 345-428
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 2.35e-24
Family Nqo1 middle domain-like 0.00077
Further Details:      
 
Domain Number 4 Region: 22-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000816
Family Thioredoxin-like 2Fe-2S ferredoxin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313673509|ref|YP_004051620.1|
Sequence length 536
Comment NADH dehydrogenase (quinone) [Calditerrivibrio nitroreducens DSM 19672]
Sequence
MLYEELLEKIDDQFLGKDKQDTISVCVAAGCLALGSDKVLEELKRIFPDRIVKGVGCLGL
CSRGALVRIEPEGFVIEHARPDNIDEIVNFIQNPKKIRDENEKFYTKQQKIVLKNCGKID
PESIEEYILNEGYKAFLKCLNELSPDEVINEVIKSGLRGRGGGGYPTGLKWSTVGKIQSP
IKYVVCNADEGDPGAFMDRAILESDPHKVIEGMLIAAYAVGANRGYVYVRAEYPLAIKRL
KTAIKNAERFNLLGANIAGTTFNFNLEVRLGAGAYVCGEETALIASIEGKKGTPRPRPPY
PAESGIKNYPTLINNVETYANISTIINNGSEWFASIGTDKSKGTKVFALSGNIKNTGLVE
VPMGIKLYDLIFEIGGGIPNDKEFKAVQTGGPSGGCIPSEYLNTSVDYESLTHLGSIMGS
GGMIVMDENTCMVDMAKFFIDFCKSESCGKCAPCRNGTVQLYEILDKITKGEGNERDLIT
MIKIANTMKKTSLCGLGQSAPNPVLSAFKYFKDEFYEHVLHRYCPAGVCKFNGGNR
Download sequence
Identical sequences E4TF17
gi|313673509|ref|YP_004051620.1| WP_013451668.1.25879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]