SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315037443|ref|YP_004031011.1| from Lactobacillus amylovorus GRL 1112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315037443|ref|YP_004031011.1|
Domain Number 1 Region: 134-230
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000222
Family Collagen-binding domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|315037443|ref|YP_004031011.1|
Domain Number - Region: 39-106
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0305
Family Mannose 6-phosphate receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|315037443|ref|YP_004031011.1|
Sequence length 364
Comment Fibronectin domain [Lactobacillus amylovorus GRL 1112]
Sequence
MKRILAMALASAAGLAFMTTPVNAASKPNMVIGQRQTLQKGQKYHFYINAAGRVRINGNA
KFTMTNSSRNKIANYGSSKNQVFYLRKGNYYLTPTNTASVNSNFTNLTKIRKDFETVVET
KKNVNDVNHPMEIKSGDHIKGMLGFYNYDETDAYTFKLYEPSKVTFDVNALPIYPGHYQY
YSLRWKLNSNGYPLNIFTKEKSQKIVYNLPQGTYTVRLSNLRGRYNFDFKIEDGSDTVPS
ASKIESVTDEKDAVRVNVAQADNAKKYELMFTQKATNGNATIGIPFQNERLVGQALGTST
TIVTDPVFHNPSYGMTFKPVDGQTYLVRVRGINSDTYRGPIDADKTPVGEWSDPYEFTYH
APKN
Download sequence
Identical sequences E4SK72
gi|315037443|ref|YP_004031011.1| WP_013437046.1.62722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]