SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|322690669|ref|YP_004220239.1| from Bifidobacterium longum subsp. longum JCM 1217

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322690669|ref|YP_004220239.1|
Domain Number 1 Region: 189-258
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000314
Family Transglutaminase, two C-terminal domains 0.0071
Further Details:      
 
Weak hits

Sequence:  gi|322690669|ref|YP_004220239.1|
Domain Number - Region: 241-260,305-341
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0994
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|322690669|ref|YP_004220239.1|
Sequence length 388
Comment hypothetical protein BLLJ_0478 [Bifidobacterium longum subsp. longum JCM 1217]
Sequence
MKHLSHRTIAIIVALLSTLSLALAVISLPHQAYAVDGTDGTSGTNSTSQGSDGDSAPIAG
PVPNIIVTNFTYGGDSVAAGADFNLDFTFQNMGQVAVTNMVITVDGGESFAIAGGTNTFY
VDALWGGYAMTQSVPMQALASAKSGAQPVTVNFRYEYVDASARSSSQSDVKISVPISQPD
RFEISDPVVPDQVIAGQENTVTMEYVNKGKGDIANVEATMEGEGFDATMKTQYVGNVASG
ATGTIGYAFTPHASGELKTTLKVTYEDSDGQTKTKEFPLAIPVTDMQPVDDSDMADPNMD
QSANQGLPVLVYVVIVVIAVVIIVVIVLLVRRRRKQKAKKNDIDEDWDDWSEGKDDKTDT
DVTDGAAADTAPIAPASPASPAGPSHKA
Download sequence
Identical sequences A0A0S2MH73 A0A1V8RGF7 C5E8F9 E8MH94 T2HZR2
WP_007051243.1.13888 WP_007051243.1.23590 WP_007051243.1.35161 WP_007051243.1.49359 WP_007051243.1.51274 WP_007051243.1.55576 WP_007051243.1.62466 WP_007051243.1.68920 WP_007051243.1.94003 WP_007051243.1.96408 WP_007051243.1.99722 gi|322690669|ref|YP_004220239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]