SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|530780118|ref|YP_008431923.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530780118|ref|YP_008431923.1|
Domain Number 1 Region: 1-73,151-333
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.31e-80
Family Pyruvate kinase 0.0000172
Further Details:      
 
Domain Number 2 Region: 318-461
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 3.27e-25
Family Pyruvate kinase, C-terminal domain 0.0027
Further Details:      
 
Domain Number 3 Region: 69-162
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000000000000785
Family Pyruvate kinase beta-barrel domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|530780118|ref|YP_008431923.1|
Sequence length 465
Comment hypothetical protein N186_02660 [Thermofilum sp. 1910b]
Sequence
MQRTKIVATLGPASWSEETIKRLILEGVRIFRLNFSHADYEKYKEIVDTLRKFETQTRPI
TILGDLQGPVIRLGNFNSFRVNPGDDVVFVNAKETAESKKVPVPYAPFFEIAKEGDEVLV
EGGALTFRVTKVGAGEAVCQAVVEGEVKPRKTVTIRGKDVPLPTITEKDMKDIEFAVKTG
FDVIALSFVRKPQDIQQLRDTLFDLGAEDVKIMAKIETKSAVESLESILQLSDAVLVARG
DLANYYELEEIYRLQNFIIREARRQGKPSVVATQLLESMINNPIPTRSEVVDVITAVRMG
ADALMLAGETAAGKYPVESVVWLKKIITEAEKLPPEPLEITSDKADLYESIAEGVVLLSK
IINAKIIAFSEKGNTARRLSKFRPQKPVILITNDLKTARYTNLMSGATPLYYPEIQKTDP
EIFQKMLAKALENSLVNVGELVVFTSGRRRGSTDLVSVERVKTSE
Download sequence
Identical sequences S5ZD35
WP_020962217.1.19067 gi|530780118|ref|YP_008431923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]