SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|530780684|ref|YP_008432492.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530780684|ref|YP_008432492.1|
Domain Number 1 Region: 4-234
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.35e-23
Family Terpene synthases 0.029
Further Details:      
 
Domain Number 2 Region: 215-301
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000000863
Family Protein prenyltransferases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530780684|ref|YP_008432492.1|
Sequence length 304
Comment hypothetical protein N186_05690 [Thermofilum sp. 1910b]
Sequence
MTRINLDAVIKYVLSKQGSDGGYLSFQYLDMFESSAEDTYYALSILETLGVEPPRRDRAV
EFLRHLQHEDGTYSSVEVAFYSIMALSLLGASPRDPRGASEYLMKALASNMNGDYILPSF
EAEQLIDESGVLKSKDATFTLTSADLTPVPIRTSMIVLALHKLGGLDGEAEEKAYPLLKD
ALSNGGLGTPVSLEVAYWALEALSTVDHLPETSNLVKWIYACENIDGGFSSTPGSKTAFI
ENLYYALRSLEILGSRPKYVSSHLEYVTSLQNANGGFRRSRELGASALDYTFHAVKSLVL
LESL
Download sequence
Identical sequences S5ZWE2
WP_020962786.1.19067 gi|530780684|ref|YP_008432492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]