SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|530780943|ref|YP_008432751.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530780943|ref|YP_008432751.1|
Domain Number 1 Region: 91-246
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.15e-28
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.00092
Further Details:      
 
Domain Number 2 Region: 6-96
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.76e-19
Family Ferredoxin reductase FAD-binding domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|530780943|ref|YP_008432751.1|
Sequence length 271
Comment hypothetical protein N186_07000 [Thermofilum sp. 1910b]
Sequence
MISLPYRVATVEEVRNLTRDIKMYTLSINETFNSDPGQYVMVWVPGVGEIPISLSLVDGE
TFCLVIARKGKVTSYIHENIKEGDKLYLRGPYGNGFKLQGGKALIVGGGYGVAPLLFLAR
ELARRYVRSDVVLGFRSKEHAILISEFEEYADRLVVSTDDGSLGVRGTAVDVARQLVDRN
IYATLYTCGKEQMMYKLVELALNRGIKTQASLERLIKCGIGICGSCVLEPLGLRVCRDGP
VFDGETLLKTVDFGRFWHDSTGKPIPIEEVK
Download sequence
Identical sequences S5ZF15
gi|530780943|ref|YP_008432751.1| WP_020963045.1.19067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]