SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330829947|ref|YP_004392899.1| from Aeromonas veronii B565

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330829947|ref|YP_004392899.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.07e-61
Family Glutathione peroxidase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330829947|ref|YP_004392899.1|
Sequence length 158
Comment glutathione peroxidase 2 [Aeromonas veronii B565]
Sequence
MPLPDLTLQRLDGTPYPLTQLAGKVVLVVNVASRCGFTPQYEGLETLYRELGPKGLVILG
FPCNQFGQQEPGDADEIARFCSLDYPVTFPIMAKCDVNGEHAHPFYQWLKQQKPGFLGLE
NVKWNFTKFLIDCNGKVVDRFAPTTKPESLAEQISEML
Download sequence
Identical sequences WP_005351277.1.12379 WP_005351277.1.36635 WP_005351277.1.64938 WP_005351277.1.99268 gi|330829947|ref|YP_004392899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]