SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325103945|ref|YP_004273599.1| from Pedobacter saltans DSM 12145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325103945|ref|YP_004273599.1|
Domain Number 1 Region: 23-200
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.38e-41
Family Glutathione peroxidase-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325103945|ref|YP_004273599.1|
Sequence length 201
Comment alkyl hydroperoxide reductase [Pedobacter saltans DSM 12145]
Sequence
MKKYILGLTVILFMAVPVKAQGYSVGDVATDFKLKNVDGKMVSLGDYKNAKGFIVVFTCN
PCPYAKLYEKRILELDKKYAAQGYPVIAINPNDPDLSREDAFDKMQERAKSRNYTFPYLV
DETQEITKVYGAKATPHTFVLKKEADKYIVEYIGAIDNDAENNNESKTKYVEEAINAIQK
GKKPTTTHTKAIGCSIKWKKA
Download sequence
Identical sequences F0SD20
WP_013632276.1.90845 gi|325103945|ref|YP_004273599.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]