SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325104287|ref|YP_004273941.1| from Pedobacter saltans DSM 12145

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325104287|ref|YP_004273941.1|
Domain Number - Region: 101-194
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00262
Family DBL homology domain (DH-domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325104287|ref|YP_004273941.1|
Sequence length 210
Comment hypothetical protein [Pedobacter saltans DSM 12145]
Sequence
MKKVLYLVCTALMLAVAPSAKAQFVVTDPANLASGIINSANEIVQTSSTVSNVIKNFNEV
KKVYDQGKEYYDKLKAINNLVKDARKVQQTVLLVGDVSEMYVQNFGKMMNDPNFTPQELV
AIGNGYSALLNESTELLKELKQIITSSSLSLNDKERMDIIDRVYKEVKDYHSLVRYYTNK
NISVSYLRAKKKNDAQRVLQLYGTANQKYW
Download sequence
Identical sequences F0S616
WP_013632617.1.90845 gi|325104287|ref|YP_004273941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]