SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325104404|ref|YP_004274058.1| from Pedobacter saltans DSM 12145

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325104404|ref|YP_004274058.1|
Domain Number - Region: 125-216
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000164
Family DBL homology domain (DH-domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325104404|ref|YP_004274058.1|
Sequence length 230
Comment hypothetical protein [Pedobacter saltans DSM 12145]
Sequence
MKPVPCNGTSFIAFKKQIIKMKKTMLLVCTAFMLAVAPSAKAQFVVTDPANLASGIINSA
NEIIQTSSTVSNVVKNFNEVKKVYEQGKEYYDKLQAVNNLVKDARKVQQTVLLVGDVSEM
YVNNFGKMMNDPNFSPQELTAIANGYSTLLNESTELLKELKQIVTSTSLSLNDKERMDII
DKVYKEVKDYHSLVRYYTNKNISVSILRAKKQNNTQRVLELYGTAEQKYW
Download sequence
Identical sequences F0S7H6
gi|325104404|ref|YP_004274058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]