SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325104043|ref|YP_004273697.1| from Pedobacter saltans DSM 12145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325104043|ref|YP_004273697.1|
Domain Number 1 Region: 170-538
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.72e-77
Family Cellulases catalytic domain 0.059
Further Details:      
 
Domain Number 2 Region: 2-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.61e-34
Family Thioltransferase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325104043|ref|YP_004273697.1|
Sequence length 669
Comment hypothetical protein [Pedobacter saltans DSM 12145]
Sequence
MANRLAQESSPYLLQHAHNPVDWFPWGKEALEKARAENKLILVSVGYSACHWCHVMEHES
FEDEEVAQIMNEHFVCIKVDREERPDIDQIYMNAVQLMTGRGGWPLNCFCLPDQRPIYGG
TYFQKEDWKNILHNLAGFYANKLQEAEEYAVRLMDGINQSERLSFVKEEKEYTQEHIENI
VKPWKMHFDFSEGGQNRAPKFPMPDNWAFLMKVAHLMKDDAAFVITRLTLDKMAAGGIYD
QLGGGFARYSVDHEWHIPHFEKMLYDNGQLMSLYADAYKYYKNERYKEVVYETYDWIKRE
MTSPEYGFYSALDADSEGVEGKFYTWDKQEIEKILDKEQAAIFNAYYAVTDEGNWEEEEI
NHLWIRKEKQHIAEAFHISIERLDEIIQHSKTQLLEYRNKRIHPGLDDKILTSWNALMLK
GLCDAYKAFADQQFLTLALDNAKFLLNNLCREDGMLYRNYKNGKATIEAFLDDYALLAQA
FISLYEVTFDEAWIFKAKSLCDYVIKHFSDAQSGMFFYTSDASEALVARKYEIMDNVIPS
SNSVMAWNLRKLSLLFDQEDYSHIYKGMLRTVEPQMASYGSAYSNWASLLLDEVFGTYEI
AITGGMSESLRKDFEKNYIPNKIILGGKSGTLPLLEDKFINGTWIFVCENKTCQLPANNI
QDAIKQILK
Download sequence
Identical sequences F0SDX9
gi|325104043|ref|YP_004273697.1| WP_013632374.1.90845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]