SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_125519 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_125519
Domain Number 1 Region: 428-607
Classification Level Classification E-value
Superfamily SIS domain 1.75e-36
Family mono-SIS domain 0.034
Further Details:      
 
Domain Number 2 Region: 27-359
Classification Level Classification E-value
Superfamily Ribokinase-like 2.13e-35
Family Ribokinase-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_125519
Sequence length 613
Comment pep:novel supercontig:GCA_000320545.1:scaffold_1:904860:908572:-1 gene:aug1.1_g227 transcript:JGI_V11_125519 description:""
Sequence
MRLRLGPAVCRPQSRLFSTLEEGRTVPVVGCGSNVVDVFFKVRSMPKPSTKVYFADPCKA
EEGKVVGGVTLNHLAWASLMGAPTGLLALQGEDDYGKMIRKKMEDLGVSTRYLKKGPEYA
TSVCHILLDSQGERAIIMAPASTGHINATAMKTHFAEALNAATIVTTEISQVPLSGVLQL
LNLASSSSHAATPLSMLDVDVPPSVAAGEANLGSLNELLQCVKTEGASCCPKEAGVDISD
MEIDDVAVLLKEAFGSRLVAVTDGKRGCGLAAERGGEGSSPSPSESSSSSTFSAQVGAYE
GVHQVDSTGAGDAFFGGMVAGLYRLGRLPETEAELAELGAISSAAGAACVEVLGALPDMD
ISPRRVVELAPTVEDWLQMSPLSASGEGASGASFSAFSPSDESGTIAGSSGLNSLECDAK
SLQSLATKAKEETQFTQSLDELCKRIYEMEKNETGRVLITGIGKSGYVARRMAATLASLS
IPSHFVHASEWGHGDFGNARKDDIVVMLSHSGNTEELVGVLHGISNRGIYTAVIVGNENS
ELSRGADVTLIASISEEETLGVVPSRSIISQEAVVNAIASEIVHRSRFSKEDFRMNHPGG
SLGNLLKQAAEDR
Download sequence
Identical sequences JGI_V11_125519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]