SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_126101 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_126101
Domain Number 1 Region: 24-208
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-43
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 454-580
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.51e-18
Family Synaptotagmin-like (S variant) 0.041
Further Details:      
 
Domain Number 3 Region: 214-319
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-17
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 355-414
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000144
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_126101
Sequence length 653
Comment pep:novel supercontig:GCA_000320545.1:scaffold_2:232257:235908:1 gene:aug1.2_g809 transcript:JGI_V11_126101 description:""
Sequence
MSFTYSKAPGGSNLKKFYGKSASSEHAARAHRTRKRVAQELLSTEESYINSLRMVCMHFQ
KPLLSAAESSRPILSHRDINLIFSNIKSIRDLNVNFYLDLRRRIENYTINTRLGKVLLDF
VPYFKMYTKYVEHTENKETREIMKMLDANTRIPRYKLLVTEYLKNTAKSHPDYQDLLKAL
EKIEETAEYMNESIKKAENRAKIIEISDLFSQDPGFVSPSRSYEMDGILFKRSRKEDIRY
RFFLFNDILAYAKETKDGYVLHRRIPIDSSFMIRPVKDKTAEPISFQIMNSVKSFEVYSA
NAEEKEKWMKSFAAVTKRVPTESNGKHSKSHQRAVLQFRKLEYCQIQKMKNGKPCRRKFG
LFTKRHNCKKCGSLCCASCSPYHVYIYEGAARKERVCTMCIRPLMELKSNRNLYKPKNLP
SIVEVSSLQTRSQSVPEASNQQSHFSCYEEGVHGTIHILLIGAKDLYMKNRTPNSYVIFS
RSGLELCKSAVARKSESPVWNQNFKFYVEDLQDPMLAEIRDANSISGQDDKIGQAIVDIC
LLGRKRGLQHWTEIPLKLDNGTLAGTIEMKIKFTPAMRKKKEQTSVYHYSFTPFYDNIFD
FLYMISVSTYSIRNVVTILARCLVALAQSSANAWFSLALTASNPPPHEQMIIS
Download sequence
Identical sequences JGI_V11_126101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]