SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_127093 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_127093
Domain Number 1 Region: 53-222
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000157
Family DBL homology domain (DH-domain) 0.0024
Further Details:      
 
Domain Number 2 Region: 313-421
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000023
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.019
Further Details:      
 
Domain Number 3 Region: 213-327
Classification Level Classification E-value
Superfamily PH domain-like 0.000000237
Family Pleckstrin-homology domain (PH domain) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_127093
Sequence length 483
Comment pep:novel supercontig:GCA_000320545.1:scaffold_3:2031541:2033954:1 gene:aug1.3_g1801 transcript:JGI_V11_127093 description:""
Sequence
MSSGQQLRDRMKSILGLVLDQEGAFFQTTEEEALRRHAYHSATSLAQKTSSVILFSLINR
IATLEEHFVRKISQNLGLIDMGRKKYRSERGVLRIAGLFIQHAPLFGLYSRYALLLPEVS
ILLKLAREDNEEFSDFLKECEQRASGDQGKPRRISNWLLAQLKDLSKYTEYLADIVKDDS
VDDEGEAFAAIERAQQMLRRSSLDIKESQEVYENEKRVNEIQDRYRGSVIKVSKPGRVLH
LKVKATKISKHNNKKEYTFLLFNDTLMYASEKKIHADYLLCNIGSEDLPEDTKLGICTRD
KAFIVEFSCKKTRDEWRRTLNALVRQNRLLRTGTTEPISGLYKVWDQTKTCSVCKKRVGY
IFSRLFHCHECGRVVCAKCSMHRVERWRLRGGSSFPNSARFSGTSNEQEGQRVCDVCMKE
IKAAEENGDKRDVTVSQLEEFQIYSPKSSIKLRNMWTINKDQSSNVNVNSSTGQGMDTDA
EKG
Download sequence
Identical sequences JGI_V11_127093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]