SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_131141 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_131141
Domain Number 1 Region: 629-820
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-23
Family DBL homology domain (DH-domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 392-429
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000489
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.019
Further Details:      
 
Weak hits

Sequence:  JGI_V11_131141
Domain Number - Region: 252-367
Classification Level Classification E-value
Superfamily PH domain-like 0.000615
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number - Region: 59-156
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.034
Family DBL homology domain (DH-domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_131141
Sequence length 1123
Comment pep:novel supercontig:GCA_000320545.1:scaffold_13:745066:750977:-1 gene:aug1.13_g5849 transcript:JGI_V11_131141 description:""
Sequence
MTSRMISELDVIIEEEVEEWNSKNDSANIPIKWATSREKFWNLCRNKATMLAESLLNFDL
PILQHPKIIMLSNTLELIQKLHCGYYKSLQALASMGRRKKRHQLEKLLIRIVGIFIKYTP
MYSLFARYSRLTFEAAKVLHQTSQNDYHLEMFIRAALCFGKEKKKKKKKKKKKKIMMMLK
EAKTNGKDLSFESCNLLIKLPLNRMLMHQSMFANIVHGMQITSAWQHRQNRAQKRLERSG
TEIEYSEEDYINMLKYQRIIDTYKCAEGIGLEETDRIFHMETLGSLVTRTGTRKNVKFLL
FNDVLMYGWARKICASFELSDSGLEEVQDKLLRDYRIGFVNTSMACIIEFRHRRDRHMWF
AKMEQLICKARVLKYNSAQPVAGLYTLARLKNRCAVCSKNIGGFFLKSYNCYKCKQLVCA
SCAKSKIRFVDTKKGEHKLPATHDRMMRTITVEAVCGTKIPAEPPITLCNTKEVARGASL
SSNSPSANGEGSPFISLRSVLYTPSTSIKTLCKEESESPKASRRLIRSKSRRRRREGRVE
KEGGLWQHKHRRAVSSSPVRRKGPSSPSTRSKCRLCSKCAERLRAVPLEARGDCNAASPA
TCEGEGLSDLKRSVDGGHLNNPFTSSYTSHSLSSPSSGKQRQKKKLSLTKGLLRAEQDYV
ALMLKTVKVVVRPTMLRAKDLAVQADPEVLDLMDLIEQISIVNFEFMKDLQSKVEHWKDD
EAIGELMLQLGPMGEVYVKYFQCYTRAFMLLEDKKWRFWFNRCRLSLGSPLQSFLSIPKR
RLEQYKAAAKGMLQATSPVHFDHRYLQEALDCMEDVLGNLPPIKKMVLSSTNSYTEREEP
ESAMESACSQVSEYRSYSRPLPYVLRHGDSKYDLKLNATANNPLASTTSSVFKSNNIKVA
SCDTTSSTILASTENTDDKATNSGNVGDISCLAVTASNEGGKDNDGDDDSKGITSSVLQN
EVMDRGAENKPSSDCSADIPAIDTELSPKQTKAMEEKGDSDEKGPSRATHGTGGNGVHGA
RLACNKRNYHRENGHAMTCSAAYANPLKDAEGNQISERRVQTPEIRRKRINTAQRHKRSK
SSGHKVIASGTRVKDLISWFTKASLLSLVESPQNIEGKHNVKR
Download sequence
Identical sequences JGI_V11_131141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]