SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_138399 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_138399
Domain Number 1 Region: 74-245,280-323
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-30
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 
Domain Number 2 Region: 450-526
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.73e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Domain Number 3 Region: 313-443
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000367
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  JGI_V11_138399
Domain Number - Region: 741-767
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.0314
Family NOB1 zinc finger-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_138399
Sequence length 782
Comment pep:novel supercontig:GCA_000320545.1:scaffold_44:613320:616932:1 gene:aug1.44_g13107 transcript:JGI_V11_138399 description:""
Sequence
MINGKDSNSTKLLHFEMRVGDEAQAKWKECNTFCYSPLRHWLPDVADPNKPSKHVKHIAK
GIASGSYDRTEKARKMDAIDKKQRECLEVEMNYVQALIGLESCYHQPLEHLLDKQDNKEQ
SVLSKSEIKLVFRNTRQLLVCHKKILVALRETIKSNGSVAVVYENFAPFLRIYTEYVNHH
DEAAEFISKALRDPAYAQFQKFVTIARSHPHTPNETLPSLLIRPIQLIPRYRLLMAELLR
LIEKRKRQERRIAMPTKFEVEAIQRAPKPKDHESFIRKLENDRELARRGLEAIANLARHI
NEGLRESERIRSLASVENEIIGLPSLTHNPKRKLVQKARFKVSSETLGEKTELAIYLLSD
MLIYAAPMRRGVCEQGWKLRVKEIIPLKGSCLKVEDVEDSRPGRHVFRIKTKTQMLAILA
ASQREKKQWLDSLKEFIRDPIEMGGDGETPTWQSDSEVTRCQACDKPFQILLRRHHCRRC
GRIFCAICTSARVYLPGVASLAHEPQRVCGGCAKALSRREKEYRTEILDALFTRARAQSC
TSSINGRIKIPVPRGIKLLKIPDENSDPIIYDSDTPTSLNSTPGSSYRSSFPLKSMSGPV
SEFSPLARLQSKSFNMESDTKSRSKSYKHIRNNFYAVGPRLRSESTGYAATIDEQKFLEA
LRIVHHEKVAMSAANSEPEMEERVSDVNRDSQPEKQKICTNVSVKFGNEAENFSSKECKN
GLSETGNNLTKDGDKIAMSRRFCTQCGSERRSRKDIFCSKCGGRRFFCASPTKMSRNTKN
DN
Download sequence
Identical sequences JGI_V11_138399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]