SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_143030 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_143030
Domain Number 1 Region: 61-177,204-291
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.24e-38
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 
Domain Number 2 Region: 578-699
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.37e-20
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 
Domain Number 3 Region: 281-407
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000584
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 4 Region: 442-493
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000911
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_143030
Sequence length 711
Comment pep:novel supercontig:GCA_000320545.1:scaffold_75:118665:125796:1 gene:aug1.75_g17738 transcript:JGI_V11_143030 description:""
Sequence
MPTATSSMKKGLDTQIRKERVNSSATVLSSLSSSSWGKAGYSSSNMSIETLDSNTATSAE
NWSKAAVDEKTAKHQRMRRKIADELLATERTYVKWLDIICDKFYVPLKERVRGSKKVLSR
REMDLIFSDIALIRNLNKNFLSVGKKEKENKTSRIPPNEEMYRQFVENAENAKTKKIMAK
LEAKSRTNKEFGLGHQVIVGQAIHPFARFCEEVCAREGCLPFAALLIAPVQRIPRYGLLI
NEYIKYTDHRHPDYYDLSTSLRKMKEIATFVNDSVRKSQNRAKIMQIKSRFLRDPGFVSP
SRLLIHEGTLMKKVYGEDKECWMLLFNDMLAITKKLLPFGRFSVVKKIPVDATFELRDVD
SDDFGVEEHSFQIINSVESIQVYAKTNAEKEMWFAAGRRVIEGYQHTRTKSLRNDMNTAM
AVLQTERLGSCQRQRRKDGLPCGNRFGIFKRRHLCTKCGTVCCSECAPYKMYIKEGDNKK
GRVCTACVMMLVGKKCNRFAFVFNPFYDPIPLVLPRFVAHCTRLNSYQTQDLALLETAHN
TVVSTLAAKSTNANSTTRTWENQENVPSGNSREAAQKSFHGTLRILLLEGKNLKMGRLHT
PDPFIIFCTADDQKARSKTIKKTTHPEWNQELRVFVDSLENPIGFKVHDARSLSKHAVIG
HGSFTINHLADAMARDMWLLAILDGRSSGYIHVKVQFLKAFKKKILRQTRY
Download sequence
Identical sequences JGI_V11_143030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]