SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_145246 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_145246
Domain Number 1 Region: 278-486
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-54
Family DBL homology domain (DH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 476-552
Classification Level Classification E-value
Superfamily PH domain-like 0.0000231
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_145246
Sequence length 661
Comment pep:novel supercontig:GCA_000320545.1:scaffold_96:271664:275519:1 gene:aug1.96_g19954 transcript:JGI_V11_145246 description:""
Sequence
MTKPIRGQTDACRLRSAEDFRDKKDFIYIIIAQWDRGNESDGRRRTIGCAGGNGSSIIII
TLVSSSRSSGILLLMSALDDSKVDDRRNSRVKRRNSGGSISHLLSFWKSVEKKNKPVKTP
LPSLRRRKWKPPKKKDNPQRVVSPKQNQTSSPQIRTNFDVTVTHEDGEATAVLRKQRPPE
EEKQSDSTRSSSVKCIVTEKGQRSPPSVSSSYLMDDEDCLAVFGLDNDEDEDQEENQEEE
EEDDEEGEEEEEINNASGNRHKDAKAAATGDEVGKRSSSSSSSSSSSKKMSTKRQKVEAE
IISSEEVYVKNLNELIKHFIHPLKSNQELLDPEDILKLFSNIELLCGFHVVFLADLKKKD
KEIHLTFQRMADFLKMYTQYVNSYDVAMTTMHRLNKKKKFKAFLDKQQAAAAQGLMSFLI
MPVQRIPRYVLLLKELIKNTNDDDQTKEPLRQSLTKVQDIAAYVNEQKRQMESRTTLLNI
SARLRNVGHFELFKPDRHLVKKGVLHSWHHRLTKQKQHHFMLFTDVVLWTSPRYSGFEQL
KLDQVSVNLSKSSSISAISNNSTRSSSSSSSSSISLANNPCTRESSTMENSAIRRGRSHS
SRGDDDAISNSHTEEGMNITKEEEGQREFGFRLHIPSSKCRSTFGIGLLRFKEEKPPTFF
G
Download sequence
Identical sequences JGI_V11_145246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]