SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_20401 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_20401
Domain Number 1 Region: 2-199
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-47
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 196-315
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-16
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 299-394
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000576
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_20401
Sequence length 394
Comment pep:novel supercontig:GCA_000320545.1:scaffold_116:53834:55518:-1 gene:gw1.116.7.1 transcript:JGI_V11_20401 description:""
Sequence
EEILSTEATYVKTLDVIIHRFQKPLLQAIAKGKPILPRDEVQELFSDIATMRDLNQKFLS
DMESLIQHYTINTTLGDTLLDFVPYFRMYRKYVENAESEKVRDIIKRLESKRKSKFKQFC
QRVCKESKCLPLPALLITPVQRIPRYRLLVQEYIKNTNEHHPDYGKLETALERIKETANF
VNESIKKRHSREKVIELMQLFKKDPGFVSPSRIYKFDGTLTKKSTRAEDRTYHFFLFNDM
LAYAHGTKPGTFRLHKKIPLDAAFEVHDVLDGKAKEKNSFQIINSVKSFQVFSSSAKGKE
EWMAMLREVTEQWKELKLKMEKRKNHMAVPQTEKNPNCQRQFKKNGRPCHRQFGMFTKRH
WCYACGILCCSSCSPYNVYVNSGEKDKNRICTKC
Download sequence
Identical sequences JGI_V11_20401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]