SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_21547 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_21547
Domain Number 1 Region: 41-289
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.24e-42
Family Nitrogenase iron protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_21547
Sequence length 296
Comment pep:novel supercontig:GCA_000320545.1:scaffold_63:161694:165450:-1 gene:gw1.63.11.1 transcript:JGI_V11_21547 description:""
Sequence
PLPPGCVGPESQMAGKASSCAGCPNQAKCASGKGAEPDPAVKEAFEGVKHTILVLSGKGG
VGKSTIASQIAWGLADAKKEVGVLDIDICGPSMPRMMGVENEEVHRSGSGWRSVPVMMMM
MMMMMMMLTNCQFWNENRNEPHCHLLTRSSYFVLVALHQTAFQMNLTDYLVVDAPPGTSD
EHISIAKLLKKVKIDGAVIVTTPQEVALLDVRKEISFCRKTKIPILGVVENMSSFSCPNC
GFKTSIFPPISGGARQMCKEMGVQYLGRSVPMDSKLLEACEKGVSFLSTYPGAPAA
Download sequence
Identical sequences JGI_V11_21547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]