SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_46781 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_46781
Domain Number 1 Region: 8-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.8e-38
Family G proteins 0.0000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_46781
Sequence length 181
Comment pep:novel supercontig:GCA_000320545.1:scaffold_7:289219:290399:-1 gene:estExt_Genewise1.C_70056 transcript:JGI_V11_46781 description:""
Sequence
MGIGRSKNPSKCLVVGLDNSGKSTIVNYLKPQKEKKEDVQATVGLTTEKFKYMGTNFTMF
DMSGAGQYRDLWQEFFVEAEGIIFVVDSADHVRLCVAKDELEGLLTHKAIKGRGIPILLF
ANKSDLKKALSAQEVSKALGLNKILGHPWMISPSCAKTGEGLESGIKWISSQLAQEKKRK
K
Download sequence
Identical sequences JGI_V11_46781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]