SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_58608 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_58608
Domain Number 1 Region: 9-595
Classification Level Classification E-value
Superfamily SIS domain 2.31e-152
Family Phosphoglucose isomerase, PGI 0.0000000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_58608
Sequence length 609
Comment pep:novel supercontig:GCA_000320545.1:scaffold_122:179655:183358:-1 gene:fgenesh1_pm.122__4 transcript:JGI_V11_58608 description:""
Sequence
MPSPAKSLSTTSEWQALQHHAKSGFPHLRDLLQDQERVEGLTLENDGFIIDFSRQKMTME
TKRLLLDLAEKANLKEKIFAMVSGAPVNPTEHRAALHMALRASKDDTFNIMEEAGDAKQS
SLSSRGDDDENGVVNVVPLVHEVLDRIEDFSSRVRDGSWAGASGRPLRNILVVGIGGSYL
GTNFVDKALLNDPQAKRRAAAARNATLRFLSNVDPVNVATTVEGMDPEESLVVVISKTFT
TAETMLNAKTLKDWLVKGQKNTKEGGEEGGPAAELEFERTVVKRHMVAVSADVEKASEFG
VDPDNVFTFWDWVGGRYSVSSAVGILPLALHYGMETVRDFLAGARAMDRHFIEAPLSANL
AAMMGLINIWQTNFQGFSTRAIIPYSHALSKFAPHVQQVGMESNGKSVTLGGEVIDYASA
EIEFGEPGTNAQHSFFQMLHQGRVVPVDFLGFTHSQNPLHLEGEPVANHDELMANFFAQP
DALAIGQTARQLREAGVAEELVPHKMMPGDRPSTVILIDRPLDAHTIGQLLALYEHRIAV
QGFMWSVNSFDQYGVELGKSLGLTVREQLIRSRTQNAPVNGFNPSTTNLLNRYLQSTAKD
NNTTTAPTT
Download sequence
Identical sequences JGI_V11_58608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]