SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_68733 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_68733
Domain Number 1 Region: 380-442,472-537
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000103
Family DBL homology domain (DH-domain) 0.0046
Further Details:      
 
Domain Number 2 Region: 943-978
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000288
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0078
Further Details:      
 
Domain Number 3 Region: 4-91
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000089
Family DBL homology domain (DH-domain) 0.01
Further Details:      
 
Domain Number 4 Region: 698-745,875-909
Classification Level Classification E-value
Superfamily PH domain-like 0.00000521
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_68733
Sequence length 1042
Comment pep:novel supercontig:GCA_000320545.1:scaffold_7:116782:122542:1 gene:fgenesh1_pg.7__28 transcript:JGI_V11_68733 description:""
Sequence
MKHVDESKTRCAFFQEKVVDELLATEASYLEQLDGLLHNLIPSLLEAAKNGNDQISMEIL
LQAKNTLGPIYGLNSRLLGNLQRKLKEPPILSLVHLRKLETLLGKMRGKSEGIDEGNQCT
ELLNSILSDRNLAISLGIQDLDFKLLHRDVVSKMKGEEVGELLGAIAEVKETIHEFYTRP
FGFVIVDEPNGKGHLVVGVTNEKLKQKLKPKSRIFSVGSTIIHSQMGATEINNILTSSKL
PLRIKFSRRKDFKGCLIIVIDEGGNELRKVSLAKGIPKDLHTKQLIMKYVSDQLEMPIES
LQFPGRLSSAVQKLIIVKVDISDHRRHFSGEVAGRRESFSRMKATHKSKRRSLMAIESVR
PCSQKVDKREDGWGKQRVRAIYLVGHIFKEICPYFRIYTPYVTFYQRFQTFWDDEYELIY
KSRNESDELELVQSSRKSRSSNAIPATYHYTYPEGMRKKLIFVRIAFILVAISSMQVPRY
KLLLQELFRYTESWHPDFEALRESVDMIHRIAAEIDRNVLEQQARSRLVCIMEKFEGEVQ
LITPSRRFIRSGVGNPECYTAATTLETVERDSRAGSGPVSPNSAMSSTPRRNLDSPADLE
EEASNANKKNTTDFVVEKAISPIKNWKGPARLSITVTPDNGSSKPTTGNAHHNLGCLSSR
RAKSPRTIFSPSPRNRNDMKIRPMSHQIYDDLKNEGDNMHLFLFNDLLIQARKMNSGEKY
LLLRWIPIDNIQEVIHPGLIAESRWQRRKYFESLCGFGFNEDSIYDAEDQEWRKALQKDT
PTKRRKNVLSTEMNLELKSVGPVLVENNSLCEGPNMTGYTHYFPRRRKNIRIHSSADLSN
TSKLCLGENFSEFLCRKGKDDNGSKLRLKATEATHFLVVLDDNKFFFIGTSDIKEKAQWM
AALISCIDERRKTIQGQKQRLRKRALQRNMSSENAGENDDSLIYRMWQADGATNNCNLCY
RAFTFFWRRHHCRHCGLLTTFARVILDFSHVHIHGFKIEAISIDSFPLASTDTFGLIVIR
VVSIDRDIMSQLLLGSATVVLR
Download sequence
Identical sequences JGI_V11_68733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]