SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_72157 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_72157
Domain Number 1 Region: 102-237
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-33
Family DBL homology domain (DH-domain) 0.00082
Further Details:      
 
Domain Number 2 Region: 226-352
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000678
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 
Domain Number 3 Region: 409-592
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000654
Family BAR domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_72157
Sequence length 643
Comment pep:novel supercontig:GCA_000320545.1:scaffold_18:909324:914774:1 gene:fgenesh1_pg.18__178 transcript:JGI_V11_72157 description:""
Sequence
MNEPILSVPFFILLLLLLLLCHCVMLCSLEKLISFFVYPLQGQNFDPALLDRPRAGSDIQ
APSPRPSSDSKKSSRRHSVAAAAVPPAHGKSESKMTSFESAKRFLDSLVNSKNVNQVFNK
MAQFFKMYTPYIQNHNNATEQLKSLTKARRSFRNAKEKCEKEAGVPLASLLILPIQRIPR
YELLLGGLIKSTHPSDGSYQDLHRALDLIKSVAVHINQSIHAREDAKKLQEIQSLFHGNA
ELVAPHRKFIMRQRMKKMTKSGRLEDREFFLFTDMLAYGSDDTMFSDKFRLRQKMKIDKS
FLVTEVQRLGPEDHLLYVSSAVKNITIFFEHEADKNKWKSALTKCMEERRKKIGYNYDRR
GSLYIRQSNNPSKSHVPRADIGPAFTSFSYGSAAEEDAKTEPRFYKDMQYIEITKKYFES
LLRQTKVYLHQQLELVKGSNSFAIKLKGEFSGLGEVPWYRALDATSNMVAVHSQEMLRWK
SVTELMIDTITWLLHGPIRSADRRKDKYEKHAYELHQARRNLDHAAKKKNAERILAAGKL
RDAAAAEHKEAKATAKKGVLDMNVAIQRGFITKLKLFVQVQADFHKDCYYDIRQCWAQVN
NAEQHHYEEGPGFLPMAFSASTLNSSDSSQRKSSEGKQASERS
Download sequence
Identical sequences JGI_V11_72157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]