SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_80145 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_80145
Domain Number 1 Region: 937-1060
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-20
Family cAMP-binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 1079-1207
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1e-19
Family Regulator of G-protein signaling, RGS 0.0012
Further Details:      
 
Domain Number 3 Region: 7-194
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000000123
Family DBL homology domain (DH-domain) 0.0042
Further Details:      
 
Domain Number 4 Region: 300-387
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000144
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 
Domain Number 5 Region: 209-314
Classification Level Classification E-value
Superfamily PH domain-like 0.000000579
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 6 Region: 705-831,870-919
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000419
Family DBL homology domain (DH-domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_80145
Sequence length 1253
Comment pep:novel supercontig:GCA_000320545.1:scaffold_68:131872:145859:-1 gene:fgenesh1_pg.68__19 transcript:JGI_V11_80145 description:""
Sequence
METSTDVIDALLSAEETDIGIIDNIQRLLVDPLKLQKASFMTECSIVQFFEFFRIISKLT
NALYNDLREANEKNAKNCSNAYLVNIISTHFPVFSLAQFYIESQVKAYWILNKARNKHPK
IDAIISSLEKAYPEHTLEDILIAPTSRIEGYLELLKDMLEEEEDGESEYIIKRIGKLLEK
KAKGVQRITREHRKQAMKKAVILKYGSKLLLERKLVKFGTITRISKSDRSKQSKEDLILF
EDTLIVTRRKKTSSTATYKLQDCAIDDIEETVVAAAFGVCTPNKVFIAKFRNLGEKEVWR
SVLMKYILQQRQRAFQSPHRPNHVSEFSIAGAKCHVCGAGARQMLFAKPFYRCRSCKKSV
CKKCASVREFPYSKTSARLCNLCWENFGSSMQAFIAQESLSSHKDSNKRSDSSFSINRSW
SGSRSTKDLQLRQSETDEKSLNTPRDSPQLTDASVRRSGKLDGKHLRASSQHTVGDQASL
SSMSSLDSETTANVGGPSQFAVLNAVESSTVIRGRIRVKRLENPSPRYEHRAPAFRRDSQ
ASYASLPIGKRKANRSELLPRSCRSPRFKTRTFDLGLAHSSSASTPRTETTQGPNSPTVS
ENRVVDKETTVKSLKMLLLEDASDDKEQSTDANEKRGSSVSTHTAHSTDLMTNKEESQEK
DPSRAQKQRRRSTMSAGYTTVTIPLVMIRYYNALEGEGDVKNGALEIAEELWHSNRVYHK
VLHKFLSRSFDTYERLAEYGLLKQTNPKIIRMLTSLRCLEIASRDVFAQLRDFLDHYPRR
GINVISSMGRLVSISILYSLYMDAVTEVIDHKKKEKDIRRWLSDVPLAISSSAVLQSARV
STSVLLLKPEKMKRAFFQYESPVARLSGKVADYLTMPTHRMSRYREICTQLRNQCGHADP
CYSRCTQILQCIEKCFAQIRPFNLSTSTDILNNEHLQFFIKARRQSIAPNIKIQIWKELK
IPIPLVRHESLSKSACVVSFGAEEVIIAEGDRSTSMYIVVYGQVKVTVGGKRVRTLESGD
ILGEIGLLVQEMKRTASCIAVVDTVLFQVDQSEFFRCINDTSSVLADVELRLEGLKCTIR
SVLHHAQASKIFKDFLDKEYAGETYEFWMEVREFRKWVSRRLVTDDFNEKTLQEKMIEKS
QQIVAKYIGSESKTPVNISMKMEARIKEQMMEGRASKTTFLEAEKEALTLMKDKFFRFKM
TKEFKKFFSGIELYQSYNGANGSNGFCGEEVNPNTEKLISKQLRGGVAEACAK
Download sequence
Identical sequences JGI_V11_80145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]