SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_80192 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_80192
Domain Number 1 Region: 629-779
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-31
Family Motor proteins 0.0012
Further Details:      
 
Domain Number 2 Region: 369-496
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-25
Family DBL homology domain (DH-domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 61-154
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000209
Family DBL homology domain (DH-domain) 0.0056
Further Details:      
 
Weak hits

Sequence:  JGI_V11_80192
Domain Number - Region: 251-567
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00863
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 486-607
Classification Level Classification E-value
Superfamily PH domain-like 0.0492
Family Pleckstrin-homology domain (PH domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_80192
Sequence length 846
Comment pep:novel supercontig:GCA_000320545.1:scaffold_68:460983:468778:1 gene:fgenesh1_pg.68__66 transcript:JGI_V11_80192 description:""
Sequence
MHIYSGLVCVESSPNNVNTADPILTTRSTSRSLDSRDNATRKKAPPSAGQTKNNPPSSSP
HSSSTRNDSKRQRPVESKSLLKTRRAIVNEIVHTEDTYVASLQLLLTDLLMPIEAKFKTK
LQKSTQLTLVSSMAALETLIVLHKRLYQDLKARAGSILATVKRERKNAARAAAQQQKKHQ
DGEARRNGRARSGYMSATKSSNQRVRSKSPMRTTFPSAQAIWSWVASWWRLKSGSLGRSR
SKFQGNNSKSPPPPRKAAPPPPPSKNAPPPPNKTSGESGESKSKAAAPKLPQRIKALKES
LQLQKRNSPKLPPKRRTTPQNSPTRTKQREQAAATSSSAAGGEGGAGRRGNDVHLPDTAV
MLAQQETEGAVIQLFHEYGAHFKMYFQYVQNYPKLALDISTSIKRSKTLKRFITDACKRN
KQHGIFSLLILPIQRIPRYVLLLESLDKSTPLLHLHLPRLELTLEKLRSVTKAIDECQRQ
SDNSLKLFTLQTTLLGTPSELQILTPSREFKRQDDVLFLKAEELGGEIDETKWSQAASVN
LLLFNDLLLIIDSVKKSGPEYVKHFFLHDITIYEGKNQSVWDLYTGSPELLYARVMFDTA
KQLRKWSETTFPAIKSAKESQMLQHNKKSSRTFQKSDSIVDRVNVYLRVRPFITKDEKEM
DEKCLSLEGDNMAVLHRPSTGGGPSERIRERVAIFDRCFDEKATQRDVFKRVGEEVLGSV
FCGYNCAIIAYGNTGSGKTHTITGEGDGHNKGILPRILEQLFRVLQRKNWYKSRIWMSFE
VVAIWHSLSYQIKHDCTISKARTGTFVSLLKLLKKIIPTRYDSAAPKARRGGRCQEWSRQ
RFGSCL
Download sequence
Identical sequences JGI_V11_80192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]