SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_84672 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_84672
Domain Number 1 Region: 9-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-51
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 217-343
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-16
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_84672
Sequence length 401
Comment pep:novel supercontig:GCA_000320545.1:scaffold_203:503:4156:-1 gene:fgenesh1_pg.203__1 transcript:JGI_V11_84672 description:""
Sequence
MSTDAAAEKRAKQLRIAMKVREEIISTEQTYVDQLNSLIEVYVKPLRGLCAEAKEKKKAP
PLELKEMRTLFGSIEQIFGINKNFLGNLKKEKEEAAEGKGVGAIFKDFAPYFKMYTDYVG
NHDRATALLEKIQKTGGRKYSAFKGFKEQKERTVLLAGLLILPIQRVPRYRLLLQELVNR
TEETHPEYPVLCEALELVKDSANHINEAVKRMDGARKVRAIQEKFIAGTHFVSPSRIFKK
EGQATKLSDGNRYRQKYHFVLFNNLFLYADTQKLSGKYKVHWQSDIKSDFDLREKEDNPN
SRYRYQFEIITKAKTFTMVFKDPSEKKAWKEKICESMEECKSNLNFERVDPPEKDNKLST
DSMIAFKRPKRPSPEAVKTLFDLHDRLEKVLVVLYDKLVGG
Download sequence
Identical sequences JGI_V11_84672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]