SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_86278 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  JGI_V11_86278
Domain Number - Region: 84-182
Classification Level Classification E-value
Superfamily SIS domain 0.00489
Family Phosphoglucose isomerase, PGI 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_86278
Sequence length 335
Comment pep:novel supercontig:GCA_000320545.1:scaffold_9:861461:865458:-1 gene:estExt_fgenesh1_pg.C_90181 transcript:JGI_V11_86278 description:""
Sequence
MQWWIMLCQKVYLLLNRLAPHTYSLKAGNPSHQDRNGDVAFSRLRNPFREDIHYIVSYTP
TDLTKTVSEMWLVVNGKEIEHVHGITLDPGRSYADEACLDRLYRFVTHFGVAKARERWAV
LHTWLRDSHQTLLLEDGNELSLDQEMKTTVSDMLSDNDAAAAAKGGGGAGTAPAATKRKL
DHKSNPSPSSGVKGSISHPPLVINADDEKTHQEEENEQKKVRFRRPTARRESVLALYFND
SASAEGQDSIKTWEDNPDDTDDEIELWCCCCCLRFECNRTAHSQKCLRSMLHECCASRKK
ASLKKRMQTVLTQSVDALLEIWVMCYGYQMLIDLS
Download sequence
Identical sequences JGI_V11_86278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]