SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_87601 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  JGI_V11_87601
Domain Number - Region: 43-110
Classification Level Classification E-value
Superfamily PH domain-like 0.0043
Family VPS36 N-terminal domain-like 0.035
Further Details:      
 
Domain Number - Region: 146-239
Classification Level Classification E-value
Superfamily PH domain-like 0.0523
Family TFIIH domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_87601
Sequence length 341
Comment pep:novel supercontig:GCA_000320545.1:scaffold_22:432734:435253:-1 gene:estExt_fgenesh1_pg.C_220075 transcript:JGI_V11_87601 description:""
Sequence
MDFTWQDREIRFDGDKYTTSLRTSEEVVQELSDVEDCKGSNNEAGRLLVTNLRIIWIFKM
NSKTNLSVGYDTIRRLAFQDPNPSFIDPRAVLNLSAKYNDGRFEFIFACAKPRASKVFRV
LAELQKSYAATRLFRDLKLRGGFIKNKQLTLLPGETMVRKLQGVFNLSADQGNLGTFFVT
NVRVVWFAEMAENFNISIPYIQITKIVMKKSAKFGKALVLQTNSFSGNYTLGFSIDPEAM
LKTLHQELTTLYEVYAKKPNFGVKYTPRKRRHSEEKGLAAKEDDVRIVTTSQMEHFDTLT
RYYADPGKGTDRKPVYDEHLGLAVEGMSGDMSTDKLWVVVA
Download sequence
Identical sequences JGI_V11_87601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]