SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_90381 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_90381
Domain Number 1 Region: 190-414
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-41
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Weak hits

Sequence:  JGI_V11_90381
Domain Number - Region: 430-551
Classification Level Classification E-value
Superfamily PH domain-like 0.00264
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_90381
Sequence length 662
Comment pep:novel supercontig:GCA_000320545.1:scaffold_69:83461:88458:1 gene:estExt_fgenesh1_pg.C_690014 transcript:JGI_V11_90381 description:""
Sequence
MMMRRNNPPRASPSMNNVNNLAMRQSIDHVEAKLYTIKGSTVSVARTSDHSSTNNDLTAA
GGVTEVDVKGTEGGHNTPDRSRRAQPVPAGKLQQERRTTIVVTDGHGALTDAAAEQQRRR
TMNVGEQERHTIAMTDDDGDGNGSNPLVASRDTMIVGGGGGGGGGGDYNNDEALDRKQQQ
GLGRGEEDPFDQLASFRKRIQTYNRVCAEIRQSESTYVESLRTVVDCFAKPFLNSVESND
SKKKGRGVVSSPAIIERRDAAMLFNNIEEILNLHESKLSQLINAPNEEIHKQFETCSSLM
ARVYSRYTNGYEKAIEVVRKYEANSKFHGLLEDACRKSNKSLGLMAYLIMPVQRIPRYAL
LFKELLKSTSEEQADQRKSIQNALRNIEEIATVINEKKRRFDNKINLCAVQAKLGRSIPR
LSDGGGLLFDLHLDGRSFLFEGKTKQLKQHSHHVKNRVVVLFSDAMLWATFPAYKYKGHR
LYKDMLFKRSEFAKTSSSTSVFVFEILPKNVELKKEKEDGGSSSAYQEDRIIFFEETKAA
RDAWVNRLLQAGVVEISQSEGLRRRQAKRRGGGQKNKRWSLRYSIFKPKKGTIILDDDDE
EEEEVQVEVEDKDVNKKKDGLEAQRCTSKSKKEHQRKKKASGIMYIARGQLDDQNDGISH
FE
Download sequence
Identical sequences JGI_V11_90381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]