SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_139404 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_139404
Domain Number 1 Region: 509-610
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000191
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_139404
Sequence length 623
Comment pep:novel supercontig:GCA_000320545.1:scaffold_50:279383:286462:1 gene:aug1.50_g14112 transcript:JGI_V11_139404 description:""
Sequence
MAKAPRASLQPPPSPSGPTEYDDSSRGAMFIWLCVWIADIILGCRIEHYASVIMGGSVLY
TSFRNQIITENDLSMIVCFAGVTALVCYVFMSEWIVALSADLVLLGYASFTLTKADAVMM
LPILCIFNTLVAPLFSGILVSPLLLCISIGIGVPLVAISELSDFSDSVEEGKDGQIEQQI
IEADEEGGMSLDFSALSESLGTSVQLLSNFFFVRSMELMSLMSSKKPKTAINDASATEIS
SPLPPIITENKSGEERGEGELKAVAALASVIQNEPLPSDTIDDETALEQDGESMVVEGVV
QGTVLEPGKKGLVVPSLASIENRRSSWRKVWLIDDDDIGWLELRVLHMGVVSAYPLGVTY
IRIPPIVRLPCNFKRDLYAEGRKVMYGESICRLDIHLHPAAARATSMTTRRRRRRKKTAN
INHDDSAAGGVAGEGGQPSSSSSSFSHRKDGAEAAHVSSRTRAKLREIGGYGDGDNDSKN
DAHAADDEDDREEEDEEKNGHTSAKVAAIYRLQYGSMGYKHTSKGRKMRWIKLSKDMQVI
EWWAPDRSKKRGGICVTDIVAVAPGWQTSVFQKASATMTPGMESKCFSIVCGSKTLDLEM
NAVGVRKQWVVDVGLLTGKRTLT
Download sequence
Identical sequences JGI_V11_139404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]