SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_144173 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_144173
Domain Number 1 Region: 104-155
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000294
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_144173
Sequence length 180
Comment pep:novel supercontig:GCA_000320545.1:scaffold_85:48404:49377:-1 gene:aug1.85_g18881 transcript:JGI_V11_144173 description:""
Sequence
MGNKFTIQGCEEPSMVGKQASFKVEPHGVTMLKTTTPDVRTQGVTEGQTFLAKYKGSNVY
VVVPKGKRSGEDLIIGLPVEAAEVQSFVEVNVENSMPGNRTKDNRKKEGYLEKTGYFNTA
YKKRFFRLAEDGKLQYFEDEQSDKANGQLYRSKEYSDEHSPLRKRGKLLYPGTVTSLIEF
Download sequence
Identical sequences JGI_V11_144173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]