SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_57484 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_57484
Domain Number 1 Region: 6-549
Classification Level Classification E-value
Superfamily SIS domain 8.9e-171
Family Phosphoglucose isomerase, PGI 0.00000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_57484
Sequence length 554
Comment pep:novel supercontig:GCA_000320545.1:scaffold_16:175657:180317:1 gene:fgenesh1_pm.16__1 transcript:JGI_V11_57484 description:""
Sequence
MPLIDSSNAWKALKAHKTSGIPHLKQLMEDNKRVDALNATFEGIYLDYSRNCVTEKTMEL
LFDLADEANVIGKFKEMAAGKKINTTEGRAVMHMALRSAPTDKFEVDGKDVVGPVHAVLK
KIKAFSDKVRSGEWKGATGKAITSVVAIGIGGSYLGAEFVAEALSTGPAAKNASGRTLEF
LANVDPVAVERALRKLDPETTMAIVISKTFTTAETMLNARTVRKWIVEALGEKAVPLHMI
ACSASPDKVKDFGINPDNMFAFWNWVGGRYSVSSAVGIMPLSLHYGFETMAEFLKGARSI
DRHLLSAPPRENLPLLMGLLGVWNSSFCGHATRAIACYAQGMLKLAPHIQQVDMESNGKR
VALNGEELTFPAGEVNFGEPGTNGQHSFYQLFHQGRVVPVDFVGFIKSNYPIDNTKSGET
VSNHDELMSNFFAQPDALAYGKGPEELKKEGVAEELIPHKTFPGNRPSNCLLVDACTPYT
VGQVLALYEHRTGVQGFVWGINSFDQFGVELGKVLGKKVRAQLAKTRGGGAKIEGFNSST
TRMLQMYINDDVRV
Download sequence
Identical sequences JGI_V11_57484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]