SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_85360 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_85360
Domain Number 1 Region: 193-309
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-18
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_85360
Sequence length 314
Comment pep:novel supercontig:GCA_000320545.1:scaffold_3:1670930:1673340:1 gene:estExt_fgenesh1_pg.C_30351 transcript:JGI_V11_85360 description:""
Sequence
MLGSLQNMLNKAKGESAQLNRDKNKVYWAQRYKRYSEHYKERAAVLAKEGDTRAPTYLDW
SKYYMERSVDQVRDIEAKSLAILVPQAVADYKKNKDKEDAQMKKEMEKNESKKPDKVEGK
SEGSSDKFVTALKVKVPKGLGSGGCFAAKYDQKDVFIVVQPGTKPGTEILFALPTGIEPV
AVETTEVKESELMGPQEKEGWLEKTGYVNTSYQKRYFKLMKNASLVYYSEAHSTKEQGSI
NLNEVTLKAKPPKDDGAPFYFIILFLKLHFRYDQGTKAVGGMASRNMKIKATSQQELDSW
ITALKSHKGLKLVE
Download sequence
Identical sequences JGI_V11_85360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]