SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_86846 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_86846
Domain Number 1 Region: 133-259
Classification Level Classification E-value
Superfamily PH domain-like 0.000002
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_86846
Sequence length 284
Comment pep:novel supercontig:GCA_000320545.1:scaffold_14:630050:631301:1 gene:estExt_fgenesh1_pg.C_140133 transcript:JGI_V11_86846 description:""
Sequence
MGGVCARSRESTNQEAMGDEIRTSKNLEKETWSEDYKLDLGSSIGKNTKTLTGEESSINT
PKSYATGTTSYCDSPRTEKDTLSENEGHKAVNPDGIENHGGDMELDENMVPFMTPSEKSA
DLLTKVVTKANETGNLVLHQGFLERACYEENSSLRKPLKWKEEFFILHQYVLFHGTNKKG
VLQQAIDGIFTKANILPLSNIASFERDKKRMGVFHLHLRSKDGKSLHLMCRSTDGGDINP
WITALRNSKSSFSKIVSDFARQNIQRRSTARARQNLAMAINGAA
Download sequence
Identical sequences JGI_V11_86846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]