SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_89913 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_89913
Domain Number 1 Region: 185-286
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.7e-17
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 26-130
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000121
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_89913
Sequence length 463
Comment pep:novel supercontig:GCA_000320545.1:scaffold_58:98132:100342:-1 gene:estExt_fgenesh1_pg.C_580016 transcript:JGI_V11_89913 description:""
Sequence
MAVSSITKSETSAINYSLGKYERPALRIAVAKLYISGPTTPTVWHDTGAWGAVILTIDRK
NGELPHLIKMVDLGKPSRVIFSQELYYEMQYSIPQPDFHTFEIKGKVVGFRFFDPNEAKI
FASTVKARLGKLLQEKIAAMESKDGSRAEGRGRKKSQYLPFGIGKKIKSFFTKEETKKVV
IGRPTDFKHVAHIGYDEDTGFDVKTIPDAWKNVFKAAGISKKQLKNKQTAKVLYKTIQQQ
MESQNGSDNQPIAHSSSQYGIPNKSVPPPPPPGGPRLPPRSKTPPPAGRRSPAPPRRSNK
APTSFNGNSGNVPPVPSNAPPLPVTGPPPPPVPMELPPPPNVPSGLPPPPNVPSGLPPPP
SITPPTFKNTKNQNKASENAPTRKTKSSSLSSAEPSLSLQDAIKNRAGNLKKVDHNERAN
EVELPQQDAIIHNLRIAMDNIRNQVTGGPEEDLEDSDEDSDWD
Download sequence
Identical sequences JGI_V11_89913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]