SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_90390 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_90390
Domain Number 1 Region: 117-186
Classification Level Classification E-value
Superfamily PH domain-like 0.0000205
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Weak hits

Sequence:  JGI_V11_90390
Domain Number - Region: 14-61
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000196
Family DBL homology domain (DH-domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_90390
Sequence length 290
Comment pep:novel supercontig:GCA_000320545.1:scaffold_69:246552:248763:-1 gene:estExt_fgenesh1_pg.C_690039 transcript:JGI_V11_90390 description:""
Sequence
MFHLCFVLYMMNSYKLLLENIIASTPPLEFTTREDLSVSFRLITDITRHINHAMGARRRA
QGFPRSQSLMLRKNQLHEKREGEGIYKKSEDKHIKPCSIPILKLIGIFLCHREGDEVKKI
LAIQSLFTGNVTLLAPHRRFILQKTVKKTTSHGDLVPRELFLFSDMLVYGAKNNFSRKLS
LRHPLKINGLFRVEDDRLNLEYNEDCDTLSYRFHSAINHIFRPDDHPLYIASQARNMMVH
FRSKEKLRFAVVGCAKADKDEFKIALDECIANRRQKIGYNNYRRGGMVSK
Download sequence
Identical sequences JGI_V11_90390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]