SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_91744 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_91744
Domain Number 1 Region: 135-257
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000158
Family Ran-binding domain 0.022
Further Details:      
 
Weak hits

Sequence:  JGI_V11_91744
Domain Number - Region: 15-117
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 0.0051
Family Variable surface antigen VlsE 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_91744
Sequence length 273
Comment pep:novel supercontig:GCA_000320545.1:scaffold_116:164568:168188:1 gene:estExt_fgenesh1_pg.C_1160035 transcript:JGI_V11_91744 description:""
Sequence
MIRILPTHANNKYDANNTITSNKTKSVFDTPSTVIGPLFGSSSSSSSHSAGSKKNGSSLT
EARGGGGDDKRKVESEDEVVEVIEKYEEGQAEKGGGALVADSKNDTGGAAVAANNSSIES
SSSSSSKDAQPEQQLNETIVWEANGELFRLNQTKWLKRGRGPFSIHQGDGYARIQMIEER
TKKQILNTPVVLHGKFDVLPTANGEGAVFTAPNFEKPLPEAIKDMDTKTADTWALSLKDK
GLVKKLSHSIMKTKEILNLEEDDGGVVKHSFQK
Download sequence
Identical sequences JGI_V11_91744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]