SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sphst1|272100|gm1.33990_g from Sphaerobolus stellatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sphst1|272100|gm1.33990_g
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.00000301
Family Fucose-specific lectin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sphst1|272100|gm1.33990_g
Sequence length 95
Sequence
MDTAPLQVYITGPDSIIHHLYLHDGGATWAEKDMGGPAIYEARAVSWDINYMRLFINTTN
GNILEKAYTSTDWWTPYLIAYNNLEGIGLTAVASR
Download sequence
Identical sequences A0A0C9UCF0
jgi|Sphst1|272100|gm1.33990_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]