SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sphst1|166902|e_gw1.37.139.1 from Sphaerobolus stellatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sphst1|166902|e_gw1.37.139.1
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000154
Family Ricin B-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sphst1|166902|e_gw1.37.139.1
Sequence length 145
Sequence
MSNFYFRLTNTFTGPNLALDVANRDTGELKMANTGNFTGQYWALILISDKPGKYRLQTLY
TGQERSLDVVNNANKDTVRLAATANVTGQFWSLKKVNGSDVLFKLYNDFTGPDKFLDVQG
SSPFTPRLASGDTTGMKWTLTLFRA
Download sequence
Identical sequences A0A0C9W1D5
jgi|Sphst1|166902|e_gw1.37.139.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]