SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sphst1|239543|gm1.1433_g from Sphaerobolus stellatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sphst1|239543|gm1.1433_g
Domain Number 1 Region: 237-326
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000204
Family UAS domain 0.077
Further Details:      
 
Domain Number 2 Region: 416-542
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000388
Family UBX domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sphst1|239543|gm1.1433_g
Sequence length 582
Sequence
MPTLDSLSLTASQRSSLDQLRAITSTGPENTGEDDEVTEQVQNEIAVLESVQWDIEQAAN
AIFSQPQATQPMASTSASSTTAAAPKPTFERFQVDDSAQGREPRNTRPPTMNFPARIFLS
LFSLASFPITLAFSIISHVLRLLRIPIPRMPISFTLSFAGLRNSLARSGMGSAANNRNGR
IPDDPFLAADRLVRELEDETGAITVSRARASAAESSGTAGPSITSLPLNPDPTRKLLPDF
HLGSYESALQLAKRDARPVCAILLSDEHDDTPPFKRNVLTDPEFVRVLTEGEFIVWIGDI
RGSEGYQASLKLTATTYPFVAFIGLQPRLPSRSQGISASSSSTSLTILSRHPSSSTPAPL
SASILAAQVTNTIIPRITPLRLQALAREEERRLRDAQDAAFRAAERADGERIMRRRREEE
DKRRKAEEEAEELLRLEEAKKLQVKEEERYKNWLSSKFADLGVEPNAGNLIRVGVRLPDG
KRVIRKFAANDELENVYVWVGALLYNVADGGSSPKDYSTYKPSEHPFSLAVAFPRKELPC
LSGQKVGDVEALQGGAQLVVEGFSSNGNGPEDDDDASASDED
Download sequence
Identical sequences jgi|Sphst1|239543|gm1.1433_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]