SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sphst1|250110|gm1.12000_g from Sphaerobolus stellatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sphst1|250110|gm1.12000_g
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000000304
Family Ricin B-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sphst1|250110|gm1.12000_g
Sequence length 147
Sequence
MTSVPDGIYRLTRGSDSDQAMTVMLGDVGANKVFLLPETVGQKNQEWKVINPSNGNVLIQ
QSASGQYLGYDGNLSDITTFVVVGTEKTEWRIQPSDNEEGRFVVVVDKSPKEQKMVLDIS
LVRTYPPMIGVLPLGYNEKQAWDFEKV
Download sequence
Identical sequences jgi|Sphst1|250110|gm1.12000_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]