SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sphst1|259350|gm1.21240_g from Sphaerobolus stellatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sphst1|259350|gm1.21240_g
Domain Number 1 Region: 9-133
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000336
Family Ricin B-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sphst1|259350|gm1.21240_g
Sequence length 135
Sequence
MSVTLKRHPDNIFKIQSVAHPTHYLQVKDGSSEHGAELIVGPEVPGSKNILFRVDTESIQ
NVATGTYAVWNESGAICSKTPQAWKIHEHDDGHHCFQVSGQDVFATATSDSGSIKTHATT
KTSSHPGQKWKIVVV
Download sequence
Identical sequences A0A0C9VKJ0
jgi|Sphst1|259350|gm1.21240_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]